UBL4A polyclonal antibody
  • UBL4A polyclonal antibody

UBL4A polyclonal antibody

Ref: AB-PAB31010
UBL4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human UBL4A.
Información adicional
Size 100 uL
Gene Name UBL4A
Gene Alias DX254E|DXS254E|G6PD|GDX|UBL4
Gene Description ubiquitin-like 4A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBL4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8266
Iso type IgG

Enviar uma mensagem


UBL4A polyclonal antibody

UBL4A polyclonal antibody