MTERFD3 polyclonal antibody
  • MTERFD3 polyclonal antibody

MTERFD3 polyclonal antibody

Ref: AB-PAB31008
MTERFD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MTERFD3.
Información adicional
Size 100 uL
Gene Name MTERFD3
Gene Alias FLJ14062|mTERFL
Gene Description MTERF domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TRTVEKLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MTERFD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 80298
Iso type IgG

Enviar uma mensagem


MTERFD3 polyclonal antibody

MTERFD3 polyclonal antibody