PRAF2 polyclonal antibody
  • PRAF2 polyclonal antibody

PRAF2 polyclonal antibody

Ref: AB-PAB31004
PRAF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PRAF2.
Información adicional
Size 100 uL
Gene Name PRAF2
Gene Alias JM4
Gene Description PRA1 domain family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PRAF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11230
Iso type IgG

Enviar uma mensagem


PRAF2 polyclonal antibody

PRAF2 polyclonal antibody