WFS1 polyclonal antibody
  • WFS1 polyclonal antibody

WFS1 polyclonal antibody

Ref: AB-PAB31000
WFS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human WFS1.
Información adicional
Size 100 uL
Gene Name WFS1
Gene Alias DFNA14|DFNA38|DFNA6|DIDMOAD|WFRS|WFS|WOLFRAMIN
Gene Description Wolfram syndrome 1 (wolframin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human WFS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7466
Iso type IgG

Enviar uma mensagem


WFS1 polyclonal antibody

WFS1 polyclonal antibody