INSL3 polyclonal antibody
  • INSL3 polyclonal antibody

INSL3 polyclonal antibody

Ref: AB-PAB30995
INSL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human INSL3.
Información adicional
Size 100 uL
Gene Name INSL3
Gene Alias MGC119818|MGC119819|RLF|RLNL
Gene Description insulin-like 3 (Leydig cell)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human INSL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3640
Iso type IgG

Enviar uma mensagem


INSL3 polyclonal antibody

INSL3 polyclonal antibody