View larger
Rabbit polyclonal antibody raised against partial recombinant human RBKS.
AB-PAB30988
New product
RBKS polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | RBKS |
| Gene Alias | DKFZp686G13268|RBSK |
| Gene Description | ribokinase |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | LNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLK |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human RBKS. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 64080 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against partial recombinant human RBKS.