RAB11FIP3 polyclonal antibody
  • RAB11FIP3 polyclonal antibody

RAB11FIP3 polyclonal antibody

Ref: AB-PAB30986
RAB11FIP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RAB11FIP3.
Información adicional
Size 100 uL
Gene Name RAB11FIP3
Gene Alias KIAA0665|Rab11-FIP3
Gene Description RAB11 family interacting protein 3 (class II)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RAB11FIP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9727
Iso type IgG

Enviar uma mensagem


RAB11FIP3 polyclonal antibody

RAB11FIP3 polyclonal antibody