ITGA6 polyclonal antibody
  • ITGA6 polyclonal antibody

ITGA6 polyclonal antibody

Ref: AB-PAB30981
ITGA6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITGA6.
Información adicional
Size 100 uL
Gene Name ITGA6
Gene Alias CD49f|DKFZp686J01244|FLJ18737|ITGA6B|VLA-6
Gene Description integrin, alpha 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITGA6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3655
Iso type IgG

Enviar uma mensagem


ITGA6 polyclonal antibody

ITGA6 polyclonal antibody