GRB10 polyclonal antibody
  • GRB10 polyclonal antibody

GRB10 polyclonal antibody

Ref: AB-PAB30979
GRB10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GRB10.
Información adicional
Size 100 uL
Gene Name GRB10
Gene Alias GRB-IR|Grb-10|IRBP|KIAA0207|MEG1|RSS
Gene Description growth factor receptor-bound protein 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GRB10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2887
Iso type IgG

Enviar uma mensagem


GRB10 polyclonal antibody

GRB10 polyclonal antibody