EPHA10 polyclonal antibody
  • EPHA10 polyclonal antibody

EPHA10 polyclonal antibody

Ref: AB-PAB30978
EPHA10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human EPHA10.
Información adicional
Size 100 uL
Gene Name EPHA10
Gene Alias FLJ16103|FLJ33655|MGC43817
Gene Description EPH receptor A10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAAS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EPHA10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 284656
Iso type IgG

Enviar uma mensagem


EPHA10 polyclonal antibody

EPHA10 polyclonal antibody