PDE7A polyclonal antibody
  • PDE7A polyclonal antibody

PDE7A polyclonal antibody

Ref: AB-PAB30975
PDE7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PDE7A.
Información adicional
Size 100 uL
Gene Name PDE7A
Gene Alias HCP1|PDE7
Gene Description phosphodiesterase 7A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PDE7A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5150
Iso type IgG

Enviar uma mensagem


PDE7A polyclonal antibody

PDE7A polyclonal antibody