MRPL41 polyclonal antibody
  • MRPL41 polyclonal antibody

MRPL41 polyclonal antibody

Ref: AB-PAB30971
MRPL41 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MRPL41.
Información adicional
Size 100 uL
Gene Name MRPL41
Gene Alias BMRP|MRP-L27|MRPL27|PIG3|RPML27
Gene Description mitochondrial ribosomal protein L41
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MRPL41.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 64975
Iso type IgG

Enviar uma mensagem


MRPL41 polyclonal antibody

MRPL41 polyclonal antibody