SCP2 polyclonal antibody
  • SCP2 polyclonal antibody

SCP2 polyclonal antibody

Ref: AB-PAB30970
SCP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SCP2.
Información adicional
Size 100 uL
Gene Name SCP2
Gene Alias DKFZp686C12188|DKFZp686D11188|NLTP|NSL-TP|SCPX
Gene Description sterol carrier protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SCP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6342
Iso type IgG

Enviar uma mensagem


SCP2 polyclonal antibody

SCP2 polyclonal antibody