RNF213 polyclonal antibody
  • RNF213 polyclonal antibody

RNF213 polyclonal antibody

Ref: AB-PAB30966
RNF213 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RNF213.
Información adicional
Size 100 uL
Gene Name RNF213
Gene Alias C17orf27|KIAA1554
Gene Description ring finger protein 213
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KDPVCLPCDHVHCLRCLRAWFASEQMICPYCLTALPDEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVSTICFKDNAPPEKEVIESLLSLLFVQKGRLRDAAQRHCEHTKSLSPFNDVVDKTPVIRSVILKLLLKYS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RNF213.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57674
Iso type IgG

Enviar uma mensagem


RNF213 polyclonal antibody

RNF213 polyclonal antibody