SGK493 polyclonal antibody
  • SGK493 polyclonal antibody

SGK493 polyclonal antibody

Ref: AB-PAB30961
SGK493 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SGK493.
Información adicional
Size 100 uL
Gene Name SGK493
Gene Alias FLJ18197|MGC125960
Gene Description protein kinase-like protein SgK493
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SGK493.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 91461
Iso type IgG

Enviar uma mensagem


SGK493 polyclonal antibody

SGK493 polyclonal antibody