ADCK5 polyclonal antibody
  • ADCK5 polyclonal antibody

ADCK5 polyclonal antibody

Ref: AB-PAB30953
ADCK5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ADCK5.
Información adicional
Size 100 uL
Gene Name ADCK5
Gene Alias FLJ35454|MGC126708
Gene Description aarF domain containing kinase 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RGVEENSPGYLEVMSACHQRAADALVAGAISNGGLYVKLGQGLCSFNHLLPPEYTRTLRVLEDRALKRGFQEVDELFLEDFQALPHELFQEFD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ADCK5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 203054
Iso type IgG

Enviar uma mensagem


ADCK5 polyclonal antibody

ADCK5 polyclonal antibody