SLC22A12 polyclonal antibody
  • SLC22A12 polyclonal antibody

SLC22A12 polyclonal antibody

Ref: AB-PAB30952
SLC22A12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLC22A12.
Información adicional
Size 100 uL
Gene Name SLC22A12
Gene Alias OAT4L|RST|URAT1
Gene Description solute carrier family 22 (organic anion/urate transporter), member 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SLC22A12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 116085
Iso type IgG

Enviar uma mensagem


SLC22A12 polyclonal antibody

SLC22A12 polyclonal antibody