EPB49 polyclonal antibody
  • EPB49 polyclonal antibody

EPB49 polyclonal antibody

Ref: AB-PAB30945
EPB49 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human EPB49.
Información adicional
Size 100 uL
Gene Name EPB49
Gene Alias DMT|FLJ78462|FLJ98848
Gene Description erythrocyte membrane protein band 4.9 (dematin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EPB49.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2039
Iso type IgG

Enviar uma mensagem


EPB49 polyclonal antibody

EPB49 polyclonal antibody