CHRM3 polyclonal antibody
  • CHRM3 polyclonal antibody

CHRM3 polyclonal antibody

Ref: AB-PAB30942
CHRM3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CHRM3.
Información adicional
Size 100 uL
Gene Name CHRM3
Gene Alias HM3
Gene Description cholinergic receptor, muscarinic 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CHRM3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1131
Iso type IgG

Enviar uma mensagem


CHRM3 polyclonal antibody

CHRM3 polyclonal antibody