DMD polyclonal antibody
  • DMD polyclonal antibody

DMD polyclonal antibody

Ref: AB-PAB30940
DMD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DMD.
Información adicional
Size 100 uL
Gene Name DMD
Gene Alias BMD|CMD3B|DXS142|DXS164|DXS206|DXS230|DXS239|DXS268|DXS269|DXS270|DXS272
Gene Description dystrophin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DMD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1756
Iso type IgG

Enviar uma mensagem


DMD polyclonal antibody

DMD polyclonal antibody