MMP16 polyclonal antibody
  • MMP16 polyclonal antibody

MMP16 polyclonal antibody

Ref: AB-PAB30939
MMP16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MMP16.
Información adicional
Size 100 uL
Gene Name MMP16
Gene Alias C8orf57|MMP-X2|MT-MMP2|MT-MMP3|MT3-MMP
Gene Description matrix metallopeptidase 16 (membrane-inserted)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MMP16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4325
Iso type IgG

Enviar uma mensagem


MMP16 polyclonal antibody

MMP16 polyclonal antibody