NKTR polyclonal antibody
  • NKTR polyclonal antibody

NKTR polyclonal antibody

Ref: AB-PAB30929
NKTR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NKTR.
Información adicional
Size 100 uL
Gene Name NKTR
Gene Alias DKFZp686F1754|DKFZp686G0426|DKFZp686J06106|DKFZp686N24126|MGC90527|p104
Gene Description natural killer-tumor recognition sequence
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMAT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NKTR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4820
Iso type IgG

Enviar uma mensagem


NKTR polyclonal antibody

NKTR polyclonal antibody