MPRIP polyclonal antibody
  • MPRIP polyclonal antibody

MPRIP polyclonal antibody

Ref: AB-PAB30928
MPRIP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MPRIP.
Información adicional
Size 100 uL
Gene Name MPRIP
Gene Alias KIAA0864|M-RIP|RHOIP3|p116Rip
Gene Description myosin phosphatase Rho interacting protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RVEGHVGELGDFQVKNSQALMCLENCREQLRSLPRASQEDEQDARAASLASVESALVSAIQALQHWPAPAHGGARAQLETGGTEENGKPASLQQCSQSELTEQEQVRLLSDQIALEASLISQIADSLKNTT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MPRIP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23164
Iso type IgG

Enviar uma mensagem


MPRIP polyclonal antibody

MPRIP polyclonal antibody