PLG polyclonal antibody
  • PLG polyclonal antibody

PLG polyclonal antibody

Ref: AB-PAB30924
PLG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PLG.
Información adicional
Size 100 uL
Gene Name PLG
Gene Alias DKFZp779M0222
Gene Description plasminogen
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PLG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5340
Iso type IgG

Enviar uma mensagem


PLG polyclonal antibody

PLG polyclonal antibody