SYCP1 polyclonal antibody
  • SYCP1 polyclonal antibody

SYCP1 polyclonal antibody

Ref: AB-PAB30918
SYCP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SYCP1.
Información adicional
Size 100 uL
Gene Name SYCP1
Gene Alias HOM-TES-14|MGC104417|SCP1
Gene Description synaptonemal complex protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQEL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SYCP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6847
Iso type IgG

Enviar uma mensagem


SYCP1 polyclonal antibody

SYCP1 polyclonal antibody