NEK1 polyclonal antibody
  • NEK1 polyclonal antibody

NEK1 polyclonal antibody

Ref: AB-PAB30916
NEK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NEK1.
Información adicional
Size 100 uL
Gene Name NEK1
Gene Alias DKFZp686D06121|DKFZp686K12169|KIAA1901|MGC138800|NY-REN-55
Gene Description NIMA (never in mitosis gene a)-related kinase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NEK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4750
Iso type IgG

Enviar uma mensagem


NEK1 polyclonal antibody

NEK1 polyclonal antibody