IFT74 polyclonal antibody
  • IFT74 polyclonal antibody

IFT74 polyclonal antibody

Ref: AB-PAB30913
IFT74 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IFT74.
Información adicional
Size 100 uL
Gene Name IFT74
Gene Alias CCDC2|CMG-1|CMG1|FLJ22621|MGC111562
Gene Description intraflagellar transport 74 homolog (Chlamydomonas)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSFENQVKYLEMKTTNEKLLQE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IFT74.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 80173
Iso type IgG

Enviar uma mensagem


IFT74 polyclonal antibody

IFT74 polyclonal antibody