MDM4 polyclonal antibody
  • MDM4 polyclonal antibody

MDM4 polyclonal antibody

Ref: AB-PAB30903
MDM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MDM4.
Información adicional
Size 100 uL
Gene Name MDM4
Gene Alias DKFZp781B1423|HDMX|MDMX|MGC132766|MRP1
Gene Description Mdm4 p53 binding protein homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MDM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4194
Iso type IgG

Enviar uma mensagem


MDM4 polyclonal antibody

MDM4 polyclonal antibody