DARC polyclonal antibody
  • DARC polyclonal antibody

DARC polyclonal antibody

Ref: AB-PAB30893
DARC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DARC.
Información adicional
Size 100 uL
Gene Name DARC
Gene Alias CCBP1|CD234|Dfy|FY|GPD|GpFy|WBCQ1
Gene Description Duffy blood group, chemokine receptor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DARC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2532
Iso type IgG

Enviar uma mensagem


DARC polyclonal antibody

DARC polyclonal antibody