MGAT3 polyclonal antibody
  • MGAT3 polyclonal antibody

MGAT3 polyclonal antibody

Ref: AB-PAB30892
MGAT3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MGAT3.
Información adicional
Size 100 uL
Gene Name MGAT3
Gene Alias FLJ43371|GNT-III|GNT3|MGC141943|MGC142278
Gene Description mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MGAT3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4248
Iso type IgG

Enviar uma mensagem


MGAT3 polyclonal antibody

MGAT3 polyclonal antibody