BMPR2 polyclonal antibody
  • BMPR2 polyclonal antibody

BMPR2 polyclonal antibody

Ref: AB-PAB30891
BMPR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BMPR2.
Información adicional
Size 100 uL
Gene Name BMPR2
Gene Alias BMPR-II|BMPR3|BMR2|BRK-3|FLJ41585|FLJ76945|PPH1|T-ALK
Gene Description bone morphogenetic protein receptor, type II (serine/threonine kinase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BMPR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 659
Iso type IgG

Enviar uma mensagem


BMPR2 polyclonal antibody

BMPR2 polyclonal antibody