TGFA polyclonal antibody
  • TGFA polyclonal antibody

TGFA polyclonal antibody

Ref: AB-PAB30875
TGFA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TGFA.
Información adicional
Size 100 uL
Gene Name TGFA
Gene Alias TFGA
Gene Description transforming growth factor, alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TGFA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7039
Iso type IgG

Enviar uma mensagem


TGFA polyclonal antibody

TGFA polyclonal antibody