PDGFRB polyclonal antibody
  • PDGFRB polyclonal antibody

PDGFRB polyclonal antibody

Ref: AB-PAB30872
PDGFRB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PDGFRB.
Información adicional
Size 100 uL
Gene Name PDGFRB
Gene Alias CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1
Gene Description platelet-derived growth factor receptor, beta polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PDGFRB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5159
Iso type IgG

Enviar uma mensagem


PDGFRB polyclonal antibody

PDGFRB polyclonal antibody