HMGB2 polyclonal antibody
  • HMGB2 polyclonal antibody

HMGB2 polyclonal antibody

Ref: AB-PAB30862
HMGB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HMGB2.
Información adicional
Size 100 uL
Gene Name HMGB2
Gene Alias HMG2
Gene Description high-mobility group box 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:250-500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HMGB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3148
Iso type IgG

Enviar uma mensagem


HMGB2 polyclonal antibody

HMGB2 polyclonal antibody