TFF1 polyclonal antibody
  • TFF1 polyclonal antibody

TFF1 polyclonal antibody

Ref: AB-PAB30859
TFF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TFF1.
Información adicional
Size 100 uL
Gene Name TFF1
Gene Alias BCEI|D21S21|HP1.A|HPS2|pNR-2|pS2
Gene Description trefoil factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-2500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TFF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7031
Iso type IgG

Enviar uma mensagem


TFF1 polyclonal antibody

TFF1 polyclonal antibody