MAD2L1 polyclonal antibody
  • MAD2L1 polyclonal antibody

MAD2L1 polyclonal antibody

Ref: AB-PAB30854
MAD2L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAD2L1.
Información adicional
Size 100 uL
Gene Name MAD2L1
Gene Alias HSMAD2|MAD2
Gene Description MAD2 mitotic arrest deficient-like 1 (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq NNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIH
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:250-500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAD2L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4085
Iso type IgG

Enviar uma mensagem


MAD2L1 polyclonal antibody

MAD2L1 polyclonal antibody