TSPAN7 polyclonal antibody
  • TSPAN7 polyclonal antibody

TSPAN7 polyclonal antibody

Ref: AB-PAB30843
TSPAN7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TSPAN7.
Información adicional
Size 100 uL
Gene Name TSPAN7
Gene Alias A15|CCG-B7|CD231|DXS1692E|MRX58|MXS1|TALLA-1|TM4SF2|TM4SF2b
Gene Description tetraspanin 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-2500)
Western Blot (1:250-500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TSPAN7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7102
Iso type IgG

Enviar uma mensagem


TSPAN7 polyclonal antibody

TSPAN7 polyclonal antibody