PHPT1 polyclonal antibody
  • PHPT1 polyclonal antibody

PHPT1 polyclonal antibody

Ref: AB-PAB30810
PHPT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PHPT1.
Información adicional
Size 100 uL
Gene Name PHPT1
Gene Alias CGI-202|DKFZp564M173|HSPC141|PHP14|bA216L13.10
Gene Description phosphohistidine phosphatase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PHPT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 29085
Iso type IgG

Enviar uma mensagem


PHPT1 polyclonal antibody

PHPT1 polyclonal antibody