PAK7 polyclonal antibody
  • PAK7 polyclonal antibody

PAK7 polyclonal antibody

Ref: AB-PAB30809
PAK7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PAK7.
Información adicional
Size 100 uL
Gene Name PAK7
Gene Alias KIAA1264|MGC26232|PAK5
Gene Description p21 protein (Cdc42/Rac)-activated kinase 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PAK7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57144
Iso type IgG

Enviar uma mensagem


PAK7 polyclonal antibody

PAK7 polyclonal antibody