SYNE1 polyclonal antibody
  • SYNE1 polyclonal antibody

SYNE1 polyclonal antibody

Ref: AB-PAB30804
SYNE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SYNE1.
Información adicional
Size 100 uL
Gene Name SYNE1
Gene Alias 8B|CPG2|DKFZp781J13156|FLJ30878|FLJ41140|KIAA0796|KIAA1262|KIAA1756|MYNE1|SCAR8
Gene Description spectrin repeat containing, nuclear envelope 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWEL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SYNE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23345
Iso type IgG

Enviar uma mensagem


SYNE1 polyclonal antibody

SYNE1 polyclonal antibody