View larger
Rabbit polyclonal antibody raised against partial recombinant human RPS6KA1.
AB-PAB30790
New product
RPS6KA1 polyclonal antibody
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | RPS6KA1 |
| Gene Alias | HU-1|MAPKAPK1A|RSK|RSK1 |
| Gene Description | ribosomal protein S6 kinase, 90kDa, polypeptide 1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P,IF |
| Immunogen Prot. Seq | KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL |
| Form | Liquid |
| Recomended Dilution | Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human RPS6KA1. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 6195 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against partial recombinant human RPS6KA1.