MINA polyclonal antibody
  • MINA polyclonal antibody

MINA polyclonal antibody

Ref: AB-PAB30782
MINA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MINA.
Información adicional
Size 100 uL
Gene Name MINA
Gene Alias DKFZp762O1912|FLJ14393|MDIG|MINA53|NO52
Gene Description MYC induced nuclear antigen
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELW
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MINA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84864
Iso type IgG

Enviar uma mensagem


MINA polyclonal antibody

MINA polyclonal antibody