FOXP4 polyclonal antibody
  • FOXP4 polyclonal antibody

FOXP4 polyclonal antibody

Ref: AB-PAB30777
FOXP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FOXP4.
Información adicional
Size 100 uL
Gene Name FOXP4
Gene Alias FLJ40908|FLJ44184|hFKHLA
Gene Description forkhead box P4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SPTLVKNMISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FOXP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 116113
Iso type IgG

Enviar uma mensagem


FOXP4 polyclonal antibody

FOXP4 polyclonal antibody