MEF2D polyclonal antibody
  • MEF2D polyclonal antibody

MEF2D polyclonal antibody

Ref: AB-PAB30776
MEF2D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MEF2D.
Información adicional
Size 100 uL
Gene Name MEF2D
Gene Alias DKFZp686I1536
Gene Description myocyte enhancer factor 2D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq QPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MEF2D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4209
Iso type IgG

Enviar uma mensagem


MEF2D polyclonal antibody

MEF2D polyclonal antibody