UBQLN2 polyclonal antibody
  • UBQLN2 polyclonal antibody

UBQLN2 polyclonal antibody

Ref: AB-PAB30759
UBQLN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human UBQLN2.
Información adicional
Size 100 uL
Gene Name UBQLN2
Gene Alias CHAP1|CHAP1/DSK2|Dsk2|HRIHFB2157|LIC-2|N4BP4|PLIC-2|PLIC2|RIHFB2157
Gene Description ubiquilin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLN
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBQLN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 29978
Iso type IgG

Enviar uma mensagem


UBQLN2 polyclonal antibody

UBQLN2 polyclonal antibody