MYST4 polyclonal antibody
  • MYST4 polyclonal antibody

MYST4 polyclonal antibody

Ref: AB-PAB30754
MYST4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MYST4.
Información adicional
Size 100 uL
Gene Name MYST4
Gene Alias DKFZp313G1618|FLJ90335|KAT6B|KIAA0383|MORF|MOZ2|qkf|querkopf
Gene Description MYST histone acetyltransferase (monocytic leukemia) 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEAL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MYST4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23522
Iso type IgG

Enviar uma mensagem


MYST4 polyclonal antibody

MYST4 polyclonal antibody