TP53INP1 polyclonal antibody
  • TP53INP1 polyclonal antibody

TP53INP1 polyclonal antibody

Ref: AB-PAB30751
TP53INP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TP53INP1.
Información adicional
Size 100 uL
Gene Name TP53INP1
Gene Alias DKFZp434M1317|FLJ22139|SIP|TP53DINP1|TP53INP1A|TP53INP1B|Teap|p53DINP1
Gene Description tumor protein p53 inducible nuclear protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TP53INP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 94241
Iso type IgG

Enviar uma mensagem


TP53INP1 polyclonal antibody

TP53INP1 polyclonal antibody