MLLT10 polyclonal antibody
  • MLLT10 polyclonal antibody

MLLT10 polyclonal antibody

Ref: AB-PAB30747
MLLT10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MLLT10.
Información adicional
Size 100 uL
Gene Name MLLT10
Gene Alias AF10|DKFZp686E10210|MGC75086
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSV
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MLLT10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8028
Iso type IgG

Enviar uma mensagem


MLLT10 polyclonal antibody

MLLT10 polyclonal antibody