BLM polyclonal antibody
  • BLM polyclonal antibody

BLM polyclonal antibody

Ref: AB-PAB30745
BLM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BLM.
Información adicional
Size 100 uL
Gene Name BLM
Gene Alias BS|MGC126616|MGC131618|MGC131620|RECQ2|RECQL2|RECQL3
Gene Description Bloom syndrome
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BLM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 641
Iso type IgG

Enviar uma mensagem


BLM polyclonal antibody

BLM polyclonal antibody