DDX20 polyclonal antibody
  • DDX20 polyclonal antibody

DDX20 polyclonal antibody

Ref: AB-PAB30738
DDX20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DDX20.
Información adicional
Size 100 uL
Gene Name DDX20
Gene Alias DKFZp434H052|DP103|GEMIN3
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDH
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DDX20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11218
Iso type IgG

Enviar uma mensagem


DDX20 polyclonal antibody

DDX20 polyclonal antibody